A practical reference on Limit of detection: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-03-03 and is reviewed periodically as new material appears.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Typical checks include retention time, peak area precision, resolution between critical pairs, tailing factor, and theoretical plate count. Acceptance criteria are set in the method or pharmacopeial monograph. If a suitability check fails, the run may be rejected and the instrument or sample preparation may need investigation. This practice helps prevent release of data from a system that has drifted out of control.
Practical HPLC testing depends on careful sample preparation and instrument maintenance. Samples may require filtration, dilution, pH adjustment, or extraction to avoid column damage and matrix interference. Mobile phases are degassed and filtered, and columns are equilibrated before injection. Common problems include peak tailing, baseline drift, ghost peaks, carryover, and co-elution of analytes. Documentation of instrument logs, calibration records, and electronic audit trails supports data integrity and traceability. Ongoing training and routine maintenance help reduce variability between analysts and laboratories.
Quality control laboratories use HPLC to check identity, purity, concentration, and stability of raw materials and finished products. A validated method specifies the column, mobile phase, flow rate, detection wavelength, injection volume, and run time. Samples are prepared and compared against reference standards of known concentration. The resulting chromatogram provides quantitative data, such as assay values and impurity levels. This approach is common in pharmaceutical, food, environmental, and industrial testing where consistent measurements are required.
| Property | Value | Notes |
|---|---|---|
| Validation parameter | Accuracy | Closeness to a reference value. |
| Validation parameter | Precision | Repeatability or intermediate precision. |
| Validation parameter | Linearity | Proportional response across a range. |
| System suitability check | Resolution | Separation between adjacent peaks. |
| Quality control tool | Control chart | Tracks results over time for trends. |
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. UV detection is widely used because many organic compounds absorb light, but it requires a chromophore. Mass spectrometry provides mass-based identification and high sensitivity for trace analytes. Each detector has trade-offs in selectivity, cost, and compatibility with mobile phases. Quantification typically uses calibration curves prepared from reference standards. Results are reported as concentration, purity, or presence above a limit.
HPLC testing separates dissolved compounds by passing a liquid sample through a column packed with stationary phase. A pump delivers mobile phase at controlled flow, and the sample components interact differently with stationary and mobile phases. Compounds that spend more time in mobile phase elute earlier; those retained by stationary phase elute later. Detectors record elution as peaks, and peak area or height relates to amount. This mechanism underpins quantitative analysis of mixtures.
Most routine HPLC testing uses reversed-phase columns, where the stationary phase is nonpolar and the mobile phase is a polar mixture such as water with an organic solvent. Analytes partition between the two phases according to polarity, size, and charge. Gradients that change solvent composition over time can separate compounds with broad retention ranges. Isocratic conditions keep solvent composition constant and suit simpler mixtures. The choice of column chemistry, pH, and temperature affects selectivity and peak shape.
The DNA in an organism's genome can be analyzed to diagnose vulnerabilities to inherited diseases, and can also be used to determine a child's paternity (genetic father) or a person's ancestry. Normally, every person carries two variations of every gene, one inherited from their mother, the other inherited from their father. The human genome is believed to contain around 20,000–25,000 genes. In addition to studying chromosomes to the level of individual genes, genetic testing in a broader sense includes biochemical tests for the possible presence of genetic diseases, or mutant forms of genes associated with increased risk of developing genetic disorders. Genetic testing identifies changes in chromosomes, genes, or proteins. Usually, testing is used to find changes that are associated with inherited disorders. The results of a genetic test can confirm or rule out a suspected genetic condition or help determine a person's chance of developing or passing on a genetic disorder. Several hundred genetic tests are currently in use, and more are being developed.
At the meeting to close the deal, one of the bankers recorded, "Michael thought he was President of the Oxford Union again, and entered into a grand oration and bored everyone stiff". In 1971 Heseltine placed his shares in a trust controlled by his ministerial boss Peter Walker and by his solicitor Charles Corman. Haymarket's pretax profits were £453,000 in 1971 and £704,000 in 1972. Haymarket was due to be floated as a public company in the autumn of 1973, although this was cancelled because of the rise in the oil price, which reduced the profitability of the publishing industry. They thus avoided the stock market crash which followed. The company remains privately owned to this day. Heseltine acted as a consultant to Haymarket during his period out of government office between 1974 and 1979. His role was to bring in new publishing ideas. He believed he increased performance, although Robert Heller later recorded that he did very little, for he was too busy as a member of the Shadow Cabinet. He worked from an office at Haymarket, near Regent Street, rather than in the House of Commons. Under the management of Masters and Tindall, Haymarket continued to grow. By 1976 it was making annual profits of round £1.75m. In 1976–1977 Heseltine, Masters, Tindall and the Finance Director David Fraser bought out the consortium's 40% share, using money borrowed from them, giving Heseltine and his family over 50% control of Haymarket. Heseltine had taken out large personal loans both to increase his stake in the company and to buy his country mansion Thenford House.
=== From conventional antibodies === Alternatively, single-domain antibodies can be made from common murine, rabbit or human IgG with four chains. The process is similar, comprising gene libraries from immunized or naïve donors and display techniques for identification of the most specific antigens. A problem with this approach is that the binding region of common IgG consists of two domains (VH and VL), which tend to dimerize or aggregate because of their lipophilicity. Monomerization is usually accomplished by replacing lipophilic by hydrophilic amino acids, but often results in a loss of affinity to the antigen. If affinity can be retained, the single-domain antibodies can likewise be produced in E. coli, S. cerevisiae or other organisms.
== The Sabres years (1958–1964) == The Sabres's popularity in the Central New York region prompted them to record a single ("Seaweed" (written by Ron Lauback) b/w "The McCoy" a Ventures song) which received airplay on WNDR radio in 1962 ("Seaweed" was produced by Joe Raposo at Raposo Studios). The Sabres played all the regional teen dances and even backed up Bobby Vee at The Three Rivers Inn one time for DJ Peter C. Cavenaugh The band changed its name to The Jazzmen in 1963, but split the following year. The British Invasion having rendered their Instrumental sound out of fashion. During this time Ron also graduated from Syracuse University (1964) and took a job with Bristol Laboratories (now known as Bristol-Myers Squibb).
=== Nationalization === After the U.S. entered World War I, due to its German connections, Merck & Co. was the subject of expropriation under the Trading with the Enemy Act of 1917. The government seized 80 percent of the shares owned by the German parent company and sold it. In 1919, George F. Merck (head of the American branch of the Merck family), in partnership with Goldman Sachs and Lehman Brothers, bought the company back at a U.S. government auction for $3.5 million, but Merck & Co. remained a separate company from its former German parent. Merck & Co. holds the trademark rights to the "Merck" name in the United States and Canada, while its former parent company retains the rights in the rest of the world; the right to use the Merck name was the subject of litigation between the two companies in 2016. In 1925, George W. Merck succeeded his father George F. Merck as president. In 1927, the corporation merged with the Powers-Weightman-Rosengarten Company, a Philadelphia quinine manufacturer. George Merck remained president and Frederic Rosengarten became chairman of the board. In 1929, H. K. Mulford Company merged with Sharp and Dohme, Inc. and brought vaccine technology, including immunization of cavalry horses in World War I and delivery of a diphtheria antitoxin to Merck & Co. In 1943, streptomycin was discovered during a Merck-funded research program in Selman Waksman's laboratory at Rutgers University. It became the first effective treatment for tuberculosis.
Sources: en.wikipedia.org
This is considered an argument for the opposite effects of tianeptine and fluoxetine on serotonin uptake, although it has been shown that fluoxetine can be partially substituted for tianeptine in animal studies. In any case, the collective research suggests that direct modulation of the serotonin system is unlikely to be the mechanism of action underlying the antidepressant effects of tianeptine.
They were the first set of nonsense mutations to be discovered, isolated by Richard H. Epstein and Charles Steinberg and named after their friend and graduate Caltech student Harris Bernstein, whose last name means "amber" in German (cf. Bernstein). Viruses with amber mutations are characterized by their ability to infect only certain strains of bacteria, known as amber suppressors. These bacteria carry their own mutation that allows a recovery of function in the mutant viruses. For example, a mutation in the tRNA that recognizes the amber stop codon allows translation to "read through" the codon and produce a full-length protein, thereby recovering the normal form of the protein and "suppressing" the amber mutation. Thus, amber mutants are an entire class of virus mutants that can grow in bacteria that contain amber suppressor mutations. Similar suppressors are known for ochre and opal stop codons as well. tRNA molecules carrying unnatural aminoacids have been designed to recognize the amber stop codon in bacterial RNA. This technology allows for incorporation of orthogonal aminoacids (such as p-azidophenylalanine) at specific locations of the target protein.
Such was the day for our regimentDread the revenge we will take.Dearly we paid for the blunder –A drawing-room General's mistake.Why weren't we told of the trenches?Why weren't we told of the wire? Why were we marched up in column,May Tommy Atkins enquire ... The nadir of Black Week was the Second Battle of Colenso on 15 December, where 21,000 British troops, commanded by Buller, attempted to cross the Tugela River to relieve Ladysmith, where 8,000 Transvaal Boers under the command of Louis Botha were waiting. Through a combination of artillery and accurate rifle fire and better use of the ground, the Boers repelled British attempts to cross the river. After his first attacks failed, Buller broke off the battle and ordered a retreat, abandoning many wounded men, several isolated units and ten field guns to be captured by Botha's men. Buller's forces lost 145 men killed and 1,200 missing or wounded and the Boers suffered only 40 casualties, including 8 killed.
Nostoc punctiforme is a species of filamentous cyanobacterium. Under non-limiting nutritional environmental conditions, its filaments are composed of photosynthetic vegetative cells; upon nutrient limitation, some of these cells undergo differentiation into heterocysts, akinetes or hormogonia. N. punctiforme is one of the Nostoc strains able to maintain diazotrophic symbiosis with higher plants such as the bryophytes Anthocerus punctatus and Blasia pusilla, water ferns from the genus Azolla, the cycads Macrozamia spp., and the angiosperm Gunnera.
The company also announced in March 2020 a partnership with Welldoc to integrate G6 CGM data with BlueStar, a digital platform for diabetes management. In November 2024, Dexcom announced a "strategic partnership" and data exchange with Oura.
Sources: en.wikipedia.org
=== Role in immune system === The coagulation system overlaps with the immune system. Coagulation can physically trap invading microbes in blood clots. Also, some products of the coagulation system can contribute to the innate immune system by their ability to increase vascular permeability and act as chemotactic agents for phagocytic cells. In addition, some of the products of the coagulation system are directly antimicrobial. For example, beta-lysine, an amino acid produced by platelets during coagulation, can cause lysis of many Gram-positive bacteria by acting as a cationic detergent. Many acute-phase proteins of inflammation are involved in the coagulation system. In addition, pathogenic bacteria may secrete agents that alter the coagulation system, e.g. coagulase and streptokinase. Immunohemostasis is the integration of immune activation into adaptive clot formation. Immunothrombosis is the pathological result of crosstalk between immunity, inflammation, and coagulation. Mediators of this process include damage-associated molecular patterns and pathogen-associated molecular patterns, which are recognized by toll-like receptors, triggering procoagulant and proinflammatory responses such as formation of neutrophil extracellular traps.
== Principles and ethical foundations == Across its applications, harm reduction prioritizes reducing adverse consequences without requiring elimination of the underlying behavior. In drug policy, this orientation is commonly described as pragmatic: it begins from the continued existence of drug use and regards reductions in harm as worthwhile outcomes even when abstinence is not achieved. Ethical defenses have also drawn on consequentialist and rights-based reasoning. Consequentialist arguments emphasize reductions in illness, death, and social costs, while rights-based arguments appeal to autonomy and opposition to paternalism. The harm can be distinguished in physical harms, dependence and social harms including health care costs and community outcomes. Social justice approaches broaden the analysis of harm beyond individual behavior to include poverty, homelessness, criminalization, violence, stigma, and barriers to health care. From this perspective, harm reduction may respond to structural inequities as well as immediate individual risk. Relational and participatory approaches emphasize that people who use drugs possess knowledge relevant to effective services and should participate in their design and governance. User-led organizations and peer practices have been important within this tradition. Ethical analysis of harm-reduction research has also used communitarian approaches, emphasizing social relationships and responsibilities alongside individual rights.
Rindo Azami (阿左美 竜胆, Azami Rindō) Voiced by: Taku Yashiro (Japanese); Lee George (English) The Agent of Autumn's Guard. He treats his job like a business, without letting his emotions get in the way. Those around him don't see it that way. He doesn't realize it, but he's overprotective of Nadeshiko.
The United States Food and Drug Administration and the European Medicines Agency have approved weight loss medications for adults with either a body-mass index (BMI) of at least 30, or a body-mass index of at least 27 with at least one weight-related comorbidity. This patient population is considered to have sufficiently high baseline health risks to justify the use of anti-obesity medication. The American Academy of Pediatrics had not previously supported the use of weight loss medication in adolescents but issued new guidelines in 2023, which recommend considering the use of weight loss medication in some overweight children aged 12 or older. The European Medicines Agency has approved semaglutide for children aged 12 or older who have a BMI in the 95 percentile for their age and a weight of at least 60 kilograms (130 lb). However, GLP-1 agonists may not be cost effective in this population.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Sources: en.wikipedia.org
Method validation is the documented process of showing that an HPLC procedure produces reliable results for a defined purpose. It examines parameters such as accuracy, precision, specificity, linearity, and robustness. Regulators and quality systems often require validation before routine use.
System suitability is a set of checks run on the chromatographic system before sample analysis. It confirms that resolution, peak shape, retention time, and response meet predefined limits. Failure can invalidate the run and trigger corrective action.
Blank injections reveal peaks or baseline disturbances that come from solvents, reagents, or the instrument rather than the sample. They help distinguish contamination from actual analyte signals. Comparing blanks with sample runs supports accurate interpretation.
Method validation is the documented process of confirming that an HPLC procedure is suitable for its intended use. It evaluates accuracy, precision, specificity, linearity, range, detection limits, and robustness. Validation criteria depend on the regulatory context and the sample type.